Protein Info for CSW01_10735 in Vibrio cholerae E7946 ATCC 55056

Annotation: succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 7 to 375 (369 residues), 618.5 bits, see alignment E=2e-190 PF01546: Peptidase_M20" amino acids 65 to 373 (309 residues), 158.5 bits, see alignment E=2.2e-50 PF07687: M20_dimer" amino acids 177 to 284 (108 residues), 92.6 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 100% identical to DAPE_VIBCH: Succinyl-diaminopimelate desuccinylase (dapE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 100% identity to vco:VC0395_A1734)

MetaCyc: 66% identical to succinyl-diaminopimelate desuccinylase (Escherichia coli K-12 substr. MG1655)
Succinyl-diaminopimelate desuccinylase. [EC: 3.5.1.18]

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>CSW01_10735 succinyl-diaminopimelate desuccinylase (Vibrio cholerae E7946 ATCC 55056)
MTDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS
PLFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEH
PDHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRR
GSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQA
GTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTG
ELLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIAD
LEKLTDMYQKTLNHLLG