Protein Info for CSW01_10670 in Vibrio cholerae E7946 ATCC 55056

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF06490: FleQ" amino acids 6 to 115 (110 residues), 105.7 bits, see alignment E=5.9e-34 PF00158: Sigma54_activat" amino acids 137 to 304 (168 residues), 252.2 bits, see alignment E=7.5e-79 PF14532: Sigma54_activ_2" amino acids 138 to 308 (171 residues), 69.1 bits, see alignment E=1.7e-22 PF07728: AAA_5" amino acids 160 to 281 (122 residues), 35.4 bits, see alignment E=3.7e-12 PF25601: AAA_lid_14" amino acids 309 to 385 (77 residues), 77.8 bits, see alignment E=1.6e-25 PF02954: HTH_8" amino acids 444 to 484 (41 residues), 48.2 bits, see alignment 2.6e-16

Best Hits

KEGG orthology group: K10941, sigma-54 specific transcriptional regulator, flagellar regulatory protein A (inferred from 100% identity to vco:VC0395_A1721)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>CSW01_10670 sigma-54-dependent Fis family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MQSLAKLLVIEDDAAIRLNLSVILEFVGEQCEVIESTQIDQINWSAVWGGCILGSLRGQA
LSEQLIQSLTKANHIPLLVANKQPYSLEEFPNYVGELDFPLNYPQLSDALRHCKEFLGRK
GFQVLATARKNTLFRSLVGQSMGIQEVRHLIEQVSTTEANVLILGESGTGKEVVARNIHY
HSGRRNGPFVPINCGAIPAELLESELFGHEKGAFTGAITARKGRFELAEGGTLFLDEIGD
MPMSMQVKLLRVLQERCFERVGGNSTIKANVRVIAATHRNLEEMIDGQKFREDLYYRLNV
FPIEMPALRDRIDDIPLLLQELMTRMEAEGAQPICFTPRAINSMMEHDWPGNVRELANLV
ERMVILYPNSLVDVNHLPTKYRYSDIPEFQPEPSRFSSVEEQERDVLEGIFAEDFNFEEP
QEFVPDIDAPQALPPEGVNLKELLADLEVNLINQALEAQGGVVARAADMLGMRRTTLVEK
MRKYNMQR