Protein Info for CSW01_10665 in Vibrio cholerae E7946 ATCC 55056

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF13188: PAS_8" amino acids 21 to 78 (58 residues), 35.2 bits, see alignment E=1.2e-12 PF00512: HisKA" amino acids 126 to 188 (63 residues), 41.7 bits, see alignment E=1.5e-14 PF02518: HATPase_c" amino acids 235 to 339 (105 residues), 89.1 bits, see alignment E=4e-29

Best Hits

KEGG orthology group: K10942, two-component system, sensor histidine kinase FlrB [EC: 2.7.13.3] (inferred from 100% identity to vco:VC0395_A1720)

Predicted SEED Role

"Flagellar sensor histidine kinase FleS" in subsystem Flagellum

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>CSW01_10665 PAS domain-containing sensor histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MMSSAVQEQHSHLDSLEDQVERYKQVLDVMPAGVILLDTQGIVREANPEAQRLLDVPLVG
EKWYSVIQIAFAPRDDDGHEISLRNGRKVRLAISASTTGQLILITDLTETRLLQSRISDL
QRLSSLGRMVASLAHQVRTPLSSAMLYAANLAAPNLPPATRERFQSKLVDRLHDLEKQVN
DMLLFAKGGDNKVVMPFSIGDLAAEFMPMVETALKNNQIDYGQEVESEETMLLGNANALA
SALSNLVMNALQIAGKGSQIDVFFRPVNGELKISVQDNGPGVPESLQHKIMEPFFTTRSQ
GTGLGLAVVQMVCRAHGGRLELISKEGEGACFTMCIPLERQADSSNSETGE