Protein Info for CSW01_10600 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellar biosynthetic protein FliO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 45 (20 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 31 to 98 (68 residues), 78.4 bits, see alignment E=1.6e-26 PF04347: FliO" amino acids 43 to 121 (79 residues), 74.4 bits, see alignment E=3.2e-25

Best Hits

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 100% identity to vco:VC0395_A1706)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>CSW01_10600 flagellar biosynthetic protein FliO (Vibrio cholerae E7946 ATCC 55056)
MRKLAALFLIPVPGLAATSSQLDLATTLGSLLFVIALILLLAWLLKRMRVPAFGQQKGLS
IIKQLPVGTRERVMIIQVGEEQYLIGVTTQSIQLLAKLDNPLIQEELPATAFSNQLMQLL
KKHETDSKT