Protein Info for CSW01_10555 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 44 (13 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details PF03458: Gly_transporter" amino acids 5 to 78 (74 residues), 81.2 bits, see alignment E=2e-27 amino acids 92 to 163 (72 residues), 78.4 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 57% identical to YICG_ECOL6: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_2038)

Predicted SEED Role

"FIG00919565: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>CSW01_10555 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MLLSVLYIIGITAEAMTGALSAGRRKMDWFGVMLVASATAIGGGTVRDILLGHYPLGWVK
NPEYLAITCVAGVLTTWVYKWVIKLKGLFIRLDALGLIVFSIIGTQVAMRMGLHPGICLV
SAVVTGVFGGLLRDLICRQPPLVLHEELYASIALLASGLYLALLEFGVSDVVSTVVTLVV
GYTLRMAAVRFKWRLPSFHLETENSIH