Protein Info for CSW01_10480 in Vibrio cholerae E7946 ATCC 55056

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF07819: PGAP1" amino acids 11 to 167 (157 residues), 93.2 bits, see alignment E=5.4e-30 PF00561: Abhydrolase_1" amino acids 15 to 242 (228 residues), 94.7 bits, see alignment E=1.9e-30 PF12146: Hydrolase_4" amino acids 15 to 241 (227 residues), 46.4 bits, see alignment E=8.4e-16 PF12697: Abhydrolase_6" amino acids 16 to 248 (233 residues), 82.3 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 48% identical to YBFF_ECOLI: Esterase YbfF (ybfF) from Escherichia coli (strain K12)

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to vco:VC0395_A1683)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>CSW01_10480 histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MSALLNYKLEGSGETVVLIHGLFGSLDNLGLLARDLKNDHQVLSLDLRNHGLSFHSDEHN
YALMAQDVNQLLEHLNLTSVVVIGHSMGGKVAMKLADIAAEKVRQLVVLDMSPVAYSQRR
HDNVFAGLEAVLVQKPTSRSEVMAILAQHIEQEGVRQFLGKSLMSEQNVMTWRFNVAALK
AHYAEILGWDIIAKCRIPTLFIKGADSDYLTTQHQPMVQAQFSQAKAHVIANTGHWLHAE
KPAEVIRAIRKFIDVPV