Protein Info for CSW01_10475 in Vibrio cholerae E7946 ATCC 55056

Annotation: replication initiation regulator SeqA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF17206: SeqA_N" amino acids 1 to 36 (36 residues), 80.1 bits, see alignment 5.4e-27 PF03925: SeqA" amino acids 68 to 175 (108 residues), 154 bits, see alignment E=1.4e-49

Best Hits

Swiss-Prot: 100% identical to SEQA_VIBCH: Negative modulator of initiation of replication (seqA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03645, negative modulator of initiation of replication (inferred from 100% identity to vcj:VCD_002271)

Predicted SEED Role

"SeqA protein, negative modulator of initiation of replication"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>CSW01_10475 replication initiation regulator SeqA (Vibrio cholerae E7946 ATCC 55056)
MKTIEVDEDLYRYIASQTLHIGESASDILRRLLNVDGELATAAPAAEPKGIVVSKDAAFD
TKIDGVKAMRSLLISDEFAGLKNAIDRFMLILSTLHRIDSASFSEATMFKGRKRVYFADN
EQTLLASGQTTKPKAIPNTPFWVITNNNTSRKQQMVEQVMVRMGFPSDIIEKVTHSI