Protein Info for CSW01_10440 in Vibrio cholerae E7946 ATCC 55056

Annotation: succinate dehydrogenase flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01816: succinate dehydrogenase, flavoprotein subunit
  • amino acids 7 to 588 (582 residues), 911.3 bits, E=1.9e-278
• TIGR01812: succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  • amino acids 9 to 588 (580 residues), 798.1 bits, E=4.3e-244
• PF00890: FAD_binding_2
  • amino acids 9 to 405 (397 residues), 400.5 bits, E=1.1e-123
• PF02910: Succ_DH_flav_C
  • amino acids 460 to 588 (129 residues), 143.7 bits, E=3.2e-46

Best Hits

Swiss-Prot: 82% identical to SDHA_ECOL6: Succinate dehydrogenase flavoprotein subunit (sdhA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00239, succinate dehydrogenase flavoprotein subunit [EC: 1.3.99.1] (inferred from 100% identity to vcm:VCM66_2013)

MetaCyc: 82% identical to succinate:quinone oxidoreductase, FAD binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• TCA cycle III (animals) (8/10 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of phenylpropanoids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Protein Sequence (588 amino acids)

>CSW01_10440 succinate dehydrogenase flavoprotein subunit (Vibrio cholerae E7946 ATCC 55056)
MTIPVRSFDAVVIGAGGAGMRAALQISEQGLTCALLSKVFPTRSHTVSAQGGITVALGNS
HKDDWQWHMYDTVKGSDYIGDQNAIEYMCKNGPESVIELERMGLPFSRFENGTIYQRPFG
GQSKEFGGEQAARTAAAADRTGHALLHTLYQQNVKHKTTIFSEWYALDLVKNQDGAVLGC
TAICMETGEICYFKAKATVLATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGRDVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQDSHGKDVEVQGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLRAQAEARPATASDIEASLARTMRWENSKGGEDPVVIRKDLQRCMQNNFSVFREGKAM
AEGLEELKVIRERLKNAHLADKSTEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAH
ARFDYPERDDENWLCHSIYNPETEQMSKREVNMTPVYRDPFPPKVRTY