Protein Info for CSW01_10335 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA polymerase sigma factor FliA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 237 (219 residues), 103.9 bits, see alignment E=6.8e-34 PF04542: Sigma70_r2" amino acids 20 to 91 (72 residues), 56.7 bits, see alignment E=3.3e-19 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 20 to 238 (219 residues), 273.7 bits, see alignment E=1.3e-85 PF04539: Sigma70_r3" amino acids 100 to 172 (73 residues), 52.5 bits, see alignment E=8.5e-18 PF08281: Sigma70_r4_2" amino acids 181 to 233 (53 residues), 34.7 bits, see alignment E=2.2e-12 PF04545: Sigma70_r4" amino acids 187 to 234 (48 residues), 65.4 bits, see alignment 5.1e-22

Best Hits

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 100% identity to vcm:VCM66_1990)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>CSW01_10335 RNA polymerase sigma factor FliA (Vibrio cholerae E7946 ATCC 55056)
MNKALTYDQYGNLNSQQLFLEKYSVLVKRIAHHLIGRLPPSVLIEDLIQAGMVGLLEAQK
NYDGSKGASFETYAGIRIRGAMLDDIRRGDWVPRSVHKHNREISQAIAVLEGELNRDPTD
AEVAKFLNMSLEQYHSVLMDINCSRIVGIEDLGVSDDAISPFEEGEDNSPFHGVAEESFR
KALVESIKSLPEREALVLSLYYDEELNLKEIGEVLGVSESRVSQILSQSMQRLRTKLSSW
TRND