Protein Info for CSW01_10310 in Vibrio cholerae E7946 ATCC 55056

Annotation: ParA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF13614: AAA_31" amino acids 4 to 180 (177 residues), 167.8 bits, see alignment E=9.8e-53 PF10609: ParA" amino acids 5 to 134 (130 residues), 34.4 bits, see alignment E=6.5e-12 PF01656: CbiA" amino acids 5 to 228 (224 residues), 78.5 bits, see alignment E=1.8e-25 PF06564: CBP_BcsQ" amino acids 6 to 154 (149 residues), 34.3 bits, see alignment E=7.5e-12 PF09140: MipZ" amino acids 6 to 49 (44 residues), 22.9 bits, see alignment 2e-08 PF00142: Fer4_NifH" amino acids 10 to 239 (230 residues), 31.2 bits, see alignment E=6.5e-11 PF02374: ArsA_ATPase" amino acids 10 to 50 (41 residues), 34 bits, see alignment 7.7e-12

Best Hits

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to vch:VC2061)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>CSW01_10310 ParA family protein (Vibrio cholerae E7946 ATCC 55056)
MIVWSVANQKGGVGKTTTTITLAGLLSQQGKRVLLVDTDPHASLTTYLGYDSDGVPASLF
DLFQLREYNEASVKPLILNTDIQGIDLIPAHMSLATLDRVMGNRSGMGLILKRALLALRH
VYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMVRTLAIMQKSRSREFK
VTIVPTMYDKRTRASLQTLNQLKKDYPDKVWTSAVPIDTKFRDASLQRLPASHFAEGSRG
VFAYKQLLLFLERLAIDE