Protein Info for CSW01_10275 in Vibrio cholerae E7946 ATCC 55056

Annotation: heme exporter protein CcmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 68 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details TIGR03141: heme exporter protein CcmD" amino acids 10 to 56 (47 residues), 55.9 bits, see alignment E=1.8e-19 PF04995: CcmD" amino acids 13 to 55 (43 residues), 59.4 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 40% identical to CCMD_SHIFL: Heme exporter protein D (ccmD) from Shigella flexneri

KEGG orthology group: K02196, heme exporter protein D (inferred from 100% identity to vcj:VCD_002312)

MetaCyc: 40% identical to cytochrome c maturation protein D (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmD, interacts with CcmCE" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (68 amino acids)

>CSW01_10275 heme exporter protein CcmD (Vibrio cholerae E7946 ATCC 55056)
MHFDSFSDFLAMGGYAAYVWSAFGLTYLSMAMLWIVSVRRKTKLLNQVRDKLARQARIDA
AKHMENTL