Protein Info for CSW01_10260 in Vibrio cholerae E7946 ATCC 55056

Annotation: thiol:disulfide interchange protein DsbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 6 to 177 (172 residues), 242.5 bits, see alignment E=1e-76 PF08534: Redoxin" amino acids 41 to 163 (123 residues), 104.6 bits, see alignment E=6.5e-34 PF00578: AhpC-TSA" amino acids 41 to 156 (116 residues), 61.9 bits, see alignment E=8.6e-21 PF13098: Thioredoxin_2" amino acids 66 to 171 (106 residues), 29.5 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 100% identical to DSBE_VIBCH: Thiol:disulfide interchange protein DsbE (dsbE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 100% identity to vcj:VCD_002315)

MetaCyc: 63% identical to thiol:disulfide oxidoreductase CcmG (Escherichia coli K-12 substr. MG1655)
1.8.4.-; RXN-21424; RXN-21425

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>CSW01_10260 thiol:disulfide interchange protein DsbE (Vibrio cholerae E7946 ATCC 55056)
MNKKILFIPLVAFLLLAGVFATQLMKNSAGDDPTKLESVLVGKTVPEFRLEDLAEPGKLY
DQSIFKGEPLLLNVWATWCPTCYAEHQYLNELAKQGVKIIGLNYKDQRDKATQWLNDLGN
PYLISLFDGNGMLGLDLGVYGAPETFLIDANGVIRYRHVGDVNSRNWQETLAPLYEKMLA
EAKQ