Protein Info for CSW01_10240 in Vibrio cholerae E7946 ATCC 55056

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 190 (181 residues), 74.5 bits, E=8.5e-25
• PF13561: adh_short_C2
  • amino acids 18 to 191 (174 residues), 49 bits, E=6.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A1635)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• superpathway of hexitol degradation (bacteria) (14/18 steps found)
• D-sorbitol degradation II (1/1 steps found)
• L-sorbose degradation (1/2 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Protein Sequence (226 amino acids)

>CSW01_10240 short-chain dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MALMDIKSAIILITSASSALGSTLATHFVRLGAKVILCDRDQQGLVDTYWRCHALSDQVA
YFHIKDFSPESIETLLDMVEQKFERAPDVLINNLPSARLPSLVDEKPSEQFIQQLAAIAS
SLFNFSHACSVRMRQRQTKGVIVNVVCYNTVQDRSGIVSANSMVSGFTQSWAQELTPFNI
RVGGVVPQIASANDEIVHWSEMREELIRNTEYIVSNEYFSGRVMSA