Protein Info for CSW01_10175 in Vibrio cholerae E7946 ATCC 55056

Annotation: Aspartate-semialdehyde dehydrogenase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to DHAS1_VIBCH: Aspartate-semialdehyde dehydrogenase 1 (asd1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to vcm:VCM66_1960)

MetaCyc: 100% identical to aspartate-beta-semialdehyde dehydrogenase subunit (Vibrio cholerae)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

aspartate superpathway (23/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
L-lysine biosynthesis I (9/9 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
norspermidine biosynthesis (6/6 steps found)
superpathway of L-threonine biosynthesis (6/6 steps found)
superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
ectoine biosynthesis (5/5 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
superpathway of polyamine biosynthesis III (7/8 steps found)
L-lysine biosynthesis III (6/7 steps found)
L-lysine biosynthesis VI (6/7 steps found)
L-homoserine biosynthesis (3/3 steps found)
dipicolinate biosynthesis (3/4 steps found)
spermidine biosynthesis II (3/4 steps found)
L-lysine biosynthesis II (6/9 steps found)
chorismate biosynthesis II (archaea) (8/12 steps found)
L-methionine biosynthesis IV (2/4 steps found)
3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
cremeomycin biosynthesis (2/7 steps found)
grixazone biosynthesis (2/8 steps found)
platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>CSW01_10175 Aspartate-semialdehyde dehydrogenase 1 (Vibrio cholerae E7946 ATCC 55056)
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIE
SLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILH
GIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGV
INDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKE
EWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHND
WVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLR
RTLRIILAEK