Protein Info for CSW01_10110 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF02504: FA_synthesis" amino acids 5 to 327 (323 residues), 341.3 bits, see alignment E=2.7e-106 TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 6 to 335 (330 residues), 354.1 bits, see alignment E=3.9e-110

Best Hits

Swiss-Prot: 100% identical to PLSX_VIBC3: Phosphate acyltransferase (plsX) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 100% identity to vco:VC0395_A1610)

MetaCyc: 40% identical to acyl phosphate synthase subunit (Streptococcus pneumoniae R6)
RXN-9590 [EC: 2.3.1.274]

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15 or 2.3.1.274

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>CSW01_10110 phosphate acyltransferase (Vibrio cholerae E7946 ATCC 55056)
MQNLTVALDAMGGDFGPRVTVPAAVQALSHFPELKVILVGDQHQITQQLSLLGYSADTRL
SIVHSDRVISNSEKPSLALRHSAGSSMGMAIDLVAENQADACVSGGNTGALMALSRFRLK
LLPGIDRPALVSALPTISGRKTWMLDLGANVSSDADSLFQFAVMGAALAEQHLQQAPRVA
ILNIGAEEIKGNDLVKRCAEMLTQTQAINFIGYIEGNQLLTDAADVIVCDGFVGNVCLKA
CEGTAQLFIDKLKKSLLASSIKGWIARKLFSELFTELKTLNPDQYNGASLLGLRGIVIKS
HGSADVSAVVNAISEAVHEVKRQVPSRISDRLEAVLLERHY