Protein Info for CSW01_10100 in Vibrio cholerae E7946 ATCC 55056

Annotation: [acyl-carrier-protein] S-malonyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00128: malonyl CoA-acyl carrier protein transacylase" amino acids 8 to 296 (289 residues), 421 bits, see alignment E=1.3e-130 PF00698: Acyl_transf_1" amino acids 12 to 304 (293 residues), 134.8 bits, see alignment E=2.5e-43

Best Hits

Swiss-Prot: 71% identical to FABD_ECOLI: Malonyl CoA-acyl carrier protein transacylase (fabD) from Escherichia coli (strain K12)

KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 100% identity to vco:VC0395_A1608)

MetaCyc: 71% identical to [acyl-carrier-protein] S-malonyltransferase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-malonyltransferase. [EC: 2.3.1.39]

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>CSW01_10100 [acyl-carrier-protein] S-malonyltransferase (Vibrio cholerae E7946 ATCC 55056)
MKERFMSKFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVED
LNQTFRTQPALLAASVAIWRVWQQLGLEQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVE
LRGQLMQQAVPAGTGAMYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDA
VERAGVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVV
AETDPVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGV
AVNDVASLDAVK