Protein Info for CSW01_10025 in Vibrio cholerae E7946 ATCC 55056

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 TIGR01064: pyruvate kinase" amino acids 6 to 479 (474 residues), 558.8 bits, see alignment E=4.3e-172 PF00224: PK" amino acids 6 to 331 (326 residues), 412.9 bits, see alignment E=9.3e-128 PF02887: PK_C" amino acids 363 to 478 (116 residues), 110.8 bits, see alignment E=4e-36

Best Hits

Swiss-Prot: 70% identical to KPYK2_SALTY: Pyruvate kinase II (pykA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 100% identity to vch:VC2008)

MetaCyc: 69% identical to pyruvate kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyruvate kinase. [EC: 2.7.1.40]

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.40

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>CSW01_10025 pyruvate kinase (Vibrio cholerae E7946 ATCC 55056)
MSSTLRRTKIVATLGPSTESPEILEAIIRAGANVVRMNFSHGTAEDHKNRAQKVREIAAK
LGRHVALLGDLQGPKIRVSTFKEGKIILNEGEHFILDAELAKGEGTQESVGIDYKKLPQD
VCNDDILLLDDGRVQLQVMRVEGNKIHTKVLVGGPLSNNKGINKKGGGLSADALTEKDKN
DIRLAAEIQVEYLAVSFPRNGEDMKFARRLAQESGLYARMVAKVERAETVSCDENIDDIV
RASDVIMVARGDLGVEIGDPELIAVQKKLISRAKKLNRVVITATQMMESMISNPMPTRAE
VMDVANAVLDGTDAVMLSGETAAGKYPVETVKAMAEVCIGAEKMIESNEQNYRIKSVFRT
EEEAIAMSTIYAANHLEGVKAMVTLTESGRTALMTSRLNSVFPIFAMSANQATLNRCALL
RGVIPFYFDTKQASGLEAAIAALDALKERNLLEEGDLVIITQGDIMGVEGSTNCMRILPV
Y