Protein Info for CSW01_09855 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  • amino acids 15 to 259 (245 residues), 284.1 bits, E=4.8e-89
• PF05057: DUF676
  • amino acids 16 to 100 (85 residues), 24.4 bits, E=4.8e-09
• PF00561: Abhydrolase_1
  • amino acids 16 to 246 (231 residues), 70.7 bits, E=3.9e-23
• PF12146: Hydrolase_4
  • amino acids 17 to 219 (203 residues), 48.4 bits, E=2e-16
• PF12697: Abhydrolase_6
  • amino acids 18 to 252 (235 residues), 80.3 bits, E=8.7e-26
• PF00975: Thioesterase
  • amino acids 18 to 96 (79 residues), 27.4 bits, E=9.6e-10

Best Hits

Swiss-Prot: 42% identical to MENH_HAEIN: Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menH) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 100% identity to vch:VC1974)

MetaCyc: 43% identical to 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. [EC: 4.2.99.20]

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Protein Sequence (263 amino acids)

>CSW01_09855 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase (Vibrio cholerae E7946 ATCC 55056)
MLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPERH
CDNFAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGH
FGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANL
GSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGH
NVHHEQPQAFAKIVQAMIHSIID