Protein Info for CSW01_09845 in Vibrio cholerae E7946 ATCC 55056

Annotation: o-succinylbenzoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF21508: MenC_N" amino acids 1 to 96 (96 residues), 134.1 bits, see alignment E=1.5e-43 TIGR01927: o-succinylbenzoate synthase" amino acids 7 to 312 (306 residues), 451 bits, see alignment E=1.1e-139 PF13378: MR_MLE_C" amino acids 130 to 283 (154 residues), 45.6 bits, see alignment E=7.2e-16

Best Hits

Swiss-Prot: 100% identical to MENC_VIBCH: o-succinylbenzoate synthase (menC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02549, O-succinylbenzoate synthase [EC: 4.2.1.113] (inferred from 100% identity to vcj:VCD_002395)

MetaCyc: 56% identical to o-succinylbenzoate synthase (Escherichia coli K-12 substr. MG1655)
o-succinylbenzoate synthase. [EC: 4.2.1.113]

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>CSW01_09845 o-succinylbenzoate synthase (Vibrio cholerae E7946 ATCC 55056)
MRHATLYRYQLPMDSGVILRNEKLTQREGFIVELTENGRTARGEIAPLPGFSRETLEDAG
LQAQALLEQWVKGHAIEWDAQHPSVAFGLSMAHYELEQALPEQGNYYVAPLCTGDPDELL
PVLNNLPGQKVAKVKVGLYEPIRDGMLVNLFLESMPDLTLRLDANRAWTPAKALKFAQYV
APSLRSRIAFLEEPCQSPSESIAFSIDTGIAIAWDETLQEAVRDADFALENLLGVKTIVI
KPTLIGSVYRVEALIEKAKTLGLQAVISSSLESSLGLNQLARLAHKLLPNEVPGLDTIGL
FRAQLETPWPNSSLPVVALQEQSIVWRSESSL