Protein Info for CSW01_09790 in Vibrio cholerae E7946 ATCC 55056

Annotation: septum site-determining protein MinD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF10609: ParA" amino acids 2 to 245 (244 residues), 58.3 bits, see alignment E=2.4e-19 PF13614: AAA_31" amino acids 3 to 151 (149 residues), 67.9 bits, see alignment E=3.3e-22 TIGR01968: septum site-determining protein MinD" amino acids 3 to 268 (266 residues), 368.8 bits, see alignment E=7.4e-115 PF09140: MipZ" amino acids 3 to 165 (163 residues), 36.8 bits, see alignment E=8.7e-13 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 30.4 bits, see alignment 7.3e-11 PF01656: CbiA" amino acids 5 to 227 (223 residues), 69.2 bits, see alignment E=9.8e-23

Best Hits

Swiss-Prot: 78% identical to MIND_SHIFL: Septum site-determining protein MinD (minD) from Shigella flexneri

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 100% identity to vcj:VCD_002406)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>CSW01_09790 septum site-determining protein MinD (Vibrio cholerae E7946 ATCC 55056)
MSRIIVVTSGKGGVGKTTSSAAIASGLALRGKKTAVIDFDIGLRNLDLIMGCERRVVYDF
VNVINGEATLNQALIKDKRNENLFILPASQTRDKDALTKDGVQRVLNDLKEMGFDFIICD
SPAGIEQGALMALYYADEAIVTTNPEVSSVRDSDRILGILDSKSMRAEQGQAPIKQHLLL
TRYNPARVTQGEMLSVQDVEEILHVPLLGVIPESQAVLNASNKGVPVIFDDQSDAGQAYQ
DTVARLLGEQVEFRFLTEAKKGIFKRLFGG