Protein Info for CSW01_09775 in Vibrio cholerae E7946 ATCC 55056

Annotation: lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 23 to 322 (300 residues), 372.1 bits, see alignment E=1e-115 PF13406: SLT_2" amino acids 23 to 319 (297 residues), 375 bits, see alignment E=1.2e-116

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to vcj:VCD_002409)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>CSW01_09775 lytic murein transglycosylase (Vibrio cholerae E7946 ATCC 55056)
MKKLLSIVLGLALSAPVLANEVSFEQYVERLKQQAREEGISERILNEAFRDVEYKPRSVV
ADKNQPEKKLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGVE
SNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSWAGAMGQ
CQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVKIPKGFD
HALEGRQPEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLVYNNYNV
LMKWNRSHYFALAVSHLADRIAF