Protein Info for CSW01_09680 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01148: CTP_transf_1
  • amino acids 42 to 307 (266 residues), 250 bits, E=1.9e-78

Best Hits

Swiss-Prot: 43% identical to YNBB_ECOLI: Uncharacterized protein YnbB (ynbB) from Escherichia coli (strain K12)

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to vcm:VCM66_1860)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• CDP-diacylglycerol biosynthesis III (4/5 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Protein Sequence (310 amino acids)

>CSW01_09680 phosphatidate cytidylyltransferase (Vibrio cholerae E7946 ATCC 55056)
MLNIPQHSLHLMLVILTILVVGTLCYLWLSRRYPERDYLELKLRIRSWWWMVAIVFVVLQ
LPLNYTLFFVGFLSFMALKEFLSIVPTRMTDRRVIFWAYLSIPFQYYWLSIGWYGMFIIF
IPVYVFLYLPMVMVLIGDTKGFIRSAGIIHWAMMLTVFCISHMAYLLVLPSLNPDAGSLG
MLLFLLVMTQFNDVAQYVWGKSFGKHKIVPKVSPNKTWQGFIGGTLTVVTVSYFAAPYLT
PLTAAQGLVGGVIIALSGFIGDLVISSVKRDLRIKDTSQFIPGHGGILDRVDSLMFTAPL
FFHYLYYLYY