Protein Info for CSW01_09670 in Vibrio cholerae E7946 ATCC 55056

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 209 to 375 (167 residues), 84 bits, see alignment E=4.9e-28 PF00990: GGDEF" amino acids 212 to 369 (158 residues), 97.7 bits, see alignment E=6.4e-32 PF00563: EAL" amino acids 393 to 628 (236 residues), 194 bits, see alignment E=2.7e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A1523)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>CSW01_09670 bifunctional diguanylate cyclase/phosphodiesterase (Vibrio cholerae E7946 ATCC 55056)
MADQQYRNHHSLTTMKKSLLAFFTLVFVMVLLSIWAMVRFTNTYNMLTKYTQLAAWSLAQ
LEVETLNFTHRLETYLLNGSRENHQAMSLNYDILWNRFDLFLTSKETQELRQQHDAQAII
QEVFTQLKRYELAVSRGDQPVLQELLQLLEPYNAQIRNLAIVNFTGESANSNIRMINENK
QQLLYFFAAILLMLILLSYMTYRSADYQQFLAWHDPLTRLKNRNFIVKKLKKRRRNQQEP
IALILFDLNRFKELNDTMGYAFGDQLLINIAELLTQRCRSFAYQCARIGADEFAVLLHPC
TGNADFFIRNLWNDLTKLVQENDPTKRLSVAMGVVTCQTQDFTESSSKLRASSLLNNADL
ALNIAKKAPEGQVVYYTRDIESAYNKKRILAEQLQQLLLDPNQSSLYLSYQPILSRDPDR
LGCEALIRWQHSEFGYINPQYLIEIAEEYGLGKKLGAWIMQQVYLALQNDWKPHNRRLDV
SINLSNSLFDETLPTLVTTIFGHHENFLNAIILELTETMTIDDFPQSLAIIESLEKMKVR
FALDDFGTGWSSLYQLNHLKFSKLKIDKSFVDNMNQNQQQAIFIASIVNLSHQLGMQVVA
EGIEQLAQLEQLKQLGVDEFQGYYFSRPITKTEFATFCDHYFSSENTSLSTQINE