Protein Info for CSW01_09650 in Vibrio cholerae E7946 ATCC 55056

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 33 to 277 (245 residues), 252.7 bits, see alignment E=1.9e-79 PF03480: DctP" amino acids 33 to 317 (285 residues), 357.1 bits, see alignment E=3.6e-111

Best Hits

Swiss-Prot: 100% identical to DCTP_VIBCH: C4-dicarboxylate-binding periplasmic protein DctP (dctP) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 100% identity to vch:VC1929)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>CSW01_09650 C4-dicarboxylate ABC transporter (Vibrio cholerae E7946 ATCC 55056)
MFKPLTLIAASILAVTSFNAAANCDPGEIVIKFSHVTNTDKHPKGIAASLLEKRVNEEMN
GKACMQVFPNSTLYDDDKVLEALLNGDVQLAAPSLSKFEKFTKKYRIFDLPFLFEDVDAV
DRFQSSAKGEELKNAMTRRGVKGLEFWHNGMKQISANKPILVPADAKGLKFRVQASDVLV
AQFEQIGANPQKMSFAETYGGLQTKVIDGQENTWSNIYGQKYFEVQDGTTETNHGILDYL
VVTSSKWWDGLPADVRDQFAKILNEVTIERNAESNKVEELNKQYIIEAGGVVRTLTPEQR
QQWVDALKPVWQKFEKDIGADLIEAALAANQK