Protein Info for CSW01_09570 in Vibrio cholerae E7946 ATCC 55056

Annotation: DUF1049 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details PF06305: LapA_dom" amino acids 22 to 83 (62 residues), 54.1 bits, see alignment E=6.1e-19

Best Hits

Swiss-Prot: 38% identical to LAPA_SHIFL: Lipopolysaccharide assembly protein A (lapA) from Shigella flexneri

KEGG orthology group: K08992, putative membrane protein (inferred from 100% identity to vch:VC1913)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (93 amino acids)

>CSW01_09570 DUF1049 domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MKIIKIVAVLALFLIALALGSQNQSVVVFNYLLAQGEFHLSTLLGTVFIVGFACAAILFG
GMHFKSQLRIRKLTKQLKLANQQSAPETKVHSG