Protein Info for CSW01_09545 in Vibrio cholerae E7946 ATCC 55056

Annotation: HTH-type transcriptional regulator CysB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00126: HTH_1
  • amino acids 3 to 64 (62 residues), 57.1 bits, E=1.4e-19
• PF03466: LysR_substrate
  • amino acids 91 to 293 (203 residues), 132.6 bits, E=1.4e-42

Best Hits

Swiss-Prot: 76% identical to CYSB_ECOLI: HTH-type transcriptional regulator CysB (cysB) from Escherichia coli (strain K12)

KEGG orthology group: K13634, LysR family transcriptional regulator, cys regulon transcriptional activator (inferred from 100% identity to vcm:VCM66_1831)

MetaCyc: 76% identical to DNA-binding transcriptional dual regulator CysB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cys regulon transcriptional activator CysB" in subsystem Cysteine Biosynthesis or DNA-binding regulatory proteins, strays

Protein Sequence (324 amino acids)

>CSW01_09545 HTH-type transcriptional regulator CysB (Vibrio cholerae E7946 ATCC 55056)
MKLQQLKYIVEVVNHNLNVSATAENLYTSQPGISKQVRLLEDELGIQIFERSGKHLTQVT
PAGEHIVRIATEILSRVESIKAVAAEHTHPEMGTLNISTTHTQARYALPEVIKGFTKRYP
RVSLHMHQGTPTQMSEAIAKGTANFAIATEALHLYQDAIMLPCYHWNRSIVVPKDHPLTK
KEQVTIEDLAAYPLVTYVFGFTGRSELDSAFNRVGMTPKVVFTATDADVIKTYVRMGIGV
GVIASMAVDKKQDTDLVAIDASHIFSASTTSIGFRRGTFLRSYMFDFMERFAPHLTRPVV
EQAISLKSNIEIAEMFKDIDLPVR