Protein Info for CSW01_09510 in Vibrio cholerae E7946 ATCC 55056

Annotation: fatty acid metabolism transcriptional regulator FadR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR02812: fatty acid metabolism transcriptional regulator FadR" amino acids 2 to 276 (275 residues), 394.2 bits, see alignment E=1.1e-122 PF00392: GntR" amino acids 12 to 71 (60 residues), 71.5 bits, see alignment E=3.7e-24 PF07840: FadR_C" amino acids 72 to 274 (203 residues), 205.6 bits, see alignment E=4.5e-65

Best Hits

Swiss-Prot: 100% identical to FADR_VIBC3: Fatty acid metabolism regulator protein (fadR) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03603, GntR family transcriptional regulator, negative regulator for fad regulon and positive regulator of fabA (inferred from 100% identity to vcj:VCD_002462)

Predicted SEED Role

"Transcriptional regulator for fatty acid degradation FadR, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>CSW01_09510 fatty acid metabolism transcriptional regulator FadR (Vibrio cholerae E7946 ATCC 55056)
MVIKAKSPAGFAEKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGW
LTIQHGKPTKVNQFMETSGLHILDTLMTLDAENATSIVEDLLAARTNISPIFMRYAFKLN
KESAERIMINVIESCEALVNAPSWDAFIAASPYAEKIQQHVKEDSEKDELKRQEILIAKT
FNFYDYMLFQRLAFHSGNQIYGLIFNGLKKLYDRVGSYYFSNPQARELAMEFYRQLLAVC
QSGEREHLPQVIRQYGIASGHIWNQMKMTLPSNFTEDDC