Protein Info for CSW01_09390 in Vibrio cholerae E7946 ATCC 55056

Annotation: SpoVR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF04293: SpoVR" amino acids 24 to 439 (416 residues), 603.7 bits, see alignment E=1.5e-185 PF24755: SpoVR_C" amino acids 443 to 495 (53 residues), 93.2 bits, see alignment 8e-31

Best Hits

Swiss-Prot: 75% identical to YCGB_ECOLI: Uncharacterized protein YcgB (ycgB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_002488)

Predicted SEED Role

"FIG004684: SpoVR-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>CSW01_09390 SpoVR family protein (Vibrio cholerae E7946 ATCC 55056)
MTTKAKAAPKRKVANSKRLPDGPDWTFELIERYHQEIRRVAELYRLDTYPNQIEIITSEQ
MMDAYSSIGMPINYNHWSFGKKFIQTEQTYKHGQMGLAYEIVINSDPCIAYLMEENTVTM
QALVMAHACYGHNSFFKGNYLFQTWTDASSIIDYLLFAKNYIAECEQKFGVNEVEKLLDS
CHALMNYGVDRYKRPEKISIAEEKARQEEREAYLQSQVNALWRTVPKKAVEQEKQRRFPS
EPQENILYFIEKHAPLLEPWQREIVRIVRKVSQYFYPQKQTQVMNEGWATFWHYTILNHL
YDEGLLSDKFMLEFLHSHTSVVAQPPYNSRYFSGINPYALGFAMFRDIKRICEEPTEEDK
EWFPELAGANWLDALHFAMRNFKDESFISQYLSPKLIRDFKFFAICDDDRKNHIEISAIH
DDLGYQQIREKLAAQYNLSNLEPNIQVYSVDVRGDRSLTLQYVPHDRIPLDPSYEEVLKH
LHRLWGFEVKLEEVKDTGRREILATCPKKNDSESRI