Protein Info for CSW01_09370 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details PF01891: CbiM" amino acids 40 to 204 (165 residues), 32.3 bits, see alignment E=4.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A1461)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>CSW01_09370 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MELAQIASTIILFIVLFWVRKDTQHALWPKFRDDKSFQHLTYFVMLGLFLLWSAQASVKE
GLSIHFLALTTLTMMYGWRSAFILTLPVSATLALFGKISFAALPEYLLLSSLLPILISYS
IFALSYHYLPRNIFVFIFVAGFFNAGVTGSLHLLLNSLYIWQLGAYDWITITDNYLIFVP
LLAFPEGLLNGMALAILAVFRPEWLRVFSDRDYLYNHYHH