Protein Info for CSW01_09320 in Vibrio cholerae E7946 ATCC 55056

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 112 (103 residues), 81.8 bits, see alignment E=2.2e-27 PF00528: BPD_transp_1" amino acids 29 to 216 (188 residues), 82.5 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 48% identical to HISM_ECO57: Histidine transport system permease protein HisM (hisM) from Escherichia coli O157:H7

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to vch:VC1861)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>CSW01_09320 amino acid ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MDFSLIIDSLPIYLSGLWTTVWLVSLSLVIGLLCAIPLAIARNSKQKWFSLPAWGYIYFL
RGTPLLVQLYLIYYGMDQWFPVKDTLWEHAWFCALVAFILNTSAYTAEIIRGAINGLPKG
EVEAAKAYGMSRFQTYQRIILPSALRRSLPAYSNEVIFMLHGSAVAGIVTIMDLTGAARL
VNSRYYAPFEAFLSAGLFYMALTFIILWCFKQAEQRFLAYLKPRS