Protein Info for CSW01_09245 in Vibrio cholerae E7946 ATCC 55056

Annotation: Holliday junction branch migration protein RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF01330: RuvA_N" amino acids 1 to 62 (62 residues), 84.5 bits, see alignment E=8.9e-28 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 203 (203 residues), 211.3 bits, see alignment E=4.5e-67 PF14520: HHH_5" amino acids 72 to 130 (59 residues), 48.7 bits, see alignment E=1.7e-16 PF07499: RuvA_C" amino acids 159 to 203 (45 residues), 64.5 bits, see alignment 2e-21

Best Hits

Swiss-Prot: 100% identical to RUVA_VIBCM: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 100% identity to vcm:VCM66_1769)

MetaCyc: 65% identical to Holliday junction branch migration complex subunit RuvA (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>CSW01_09245 Holliday junction branch migration protein RuvA (Vibrio cholerae E7946 ATCC 55056)
MIGRLRGTLIEKLPPQILIEVGGIGYEVQMPMSCIYELPNIGEEAIIYTHFVVREDAQLL
YGFNTVSERALFREVIKANGVGPKMGLAILSGMTANQFVTCVEKEDISTLIKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPATDAAPVDSTPVIAQNAQEEAMSALLALGYKPPQASK
AVSQVAKAGMSSEELIREALKSMV