Protein Info for CSW01_09195 in Vibrio cholerae E7946 ATCC 55056

Annotation: protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 16 to 447 (432 residues), 575 bits, see alignment E=4.6e-177 PF04052: TolB_N" amino acids 24 to 126 (103 residues), 115 bits, see alignment E=4.4e-37 PF07676: PD40" amino acids 217 to 248 (32 residues), 35.8 bits, see alignment (E = 1.5e-12) amino acids 257 to 291 (35 residues), 30.8 bits, see alignment 5.3e-11 amino acids 301 to 336 (36 residues), 52.1 bits, see alignment 1.1e-17

Best Hits

Swiss-Prot: 100% identical to TOLB_VIBC3: Tol-Pal system protein TolB (tolB) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to vch:VC1836)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>CSW01_09195 protein TolB (Vibrio cholerae E7946 ATCC 55056)
MFKRLVFVLMLIGTGFSNIANAALELVITDGIDSARPIAIVPFKWEGATKLPEDVSAVIA
SDLQRSGKFSPVPTSKMPQTPYSEEQVNFGKWTSMGVDSLLTGTITQNAEGSYVISYQLV
DIVRGQLTQGQSKALSQDGQLVLSKDHVLFNKVATVPASRMREYAHRIADLVYEELTGER
GAFLTRIAYVVVNDKDPYPYQLRIADYDGYNERLVLRSKQPLMSPAWSPDGQTLAYVSFQ
NGQAEIYMMNIYSGKREKLTSFPRHNGAPRFSPDGKTLALVLSKTGNLQVYTMDLATRRL
TEVTSGRSNNTEPFWHPDGKSLIFTSDRGGKPQIYQVNLSGGETKRLTWQGSQNLGGQIT
PDGKFLVMVNRSDSGFNLAKQDLETGAMQILTKTLLDESPSIAPNGGMVIYSSIYNKANV
LSMVSIDGRFKARLPATNGRVRAPAWSPFL