Protein Info for CSW01_09185 in Vibrio cholerae E7946 ATCC 55056

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 42 to 112 (71 residues), 78.9 bits, see alignment E=9.1e-26 TIGR02795: tol-pal system protein YbgF" amino acids 137 to 253 (117 residues), 119.6 bits, see alignment E=5.7e-39 PF13432: TPR_16" amino acids 148 to 201 (54 residues), 26.1 bits, see alignment E=3.4e-09 amino acids 209 to 244 (36 residues), 17.7 bits, see alignment 1.5e-06 PF13174: TPR_6" amino acids 149 to 170 (22 residues), 16.9 bits, see alignment (E = 2.8e-06) amino acids 176 to 202 (27 residues), 13 bits, see alignment (E = 4.9e-05) amino acids 211 to 243 (33 residues), 29.1 bits, see alignment 3.8e-10 PF13181: TPR_8" amino acids 174 to 201 (28 residues), 12.7 bits, see alignment (E = 4.5e-05) amino acids 210 to 242 (33 residues), 19.9 bits, see alignment 2.1e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1757)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>CSW01_09185 tol-pal system protein YbgF (Vibrio cholerae E7946 ATCC 55056)
MFSNLKHVVMLMLLASAASYALAAPAPVSDLGSNVSGGSRSSEIERLERLLESRNLVQLQ
MQKQLDDMALEVNELRGQIEKNNYDMQQMLQRQRELFVELDRVRGEMKSPSSGAGQLPTS
SNDEAAQGTFSSDANEQAAYQNAVDLILKKRDYAGAIAAFQKFQTDYPNSTFSANAHYWL
GQLYFAKKEDKEAAKSFAAVVSDKGSNKRADALVKLGDIAKRNNNAEQARKFYQQAVDEY
PDSASAKIAKENLK