Protein Info for CSW01_09165 in Vibrio cholerae E7946 ATCC 55056

Annotation: L-alanine exporter AlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details PF06610: AlaE" amino acids 8 to 142 (135 residues), 232.3 bits, see alignment E=1e-73

Best Hits

Swiss-Prot: 100% identical to ALAE_VIBCH: L-alanine exporter AlaE (alaE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1751)

MetaCyc: 63% identical to AlaE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-469

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>CSW01_09165 L-alanine exporter AlaE (Vibrio cholerae E7946 ATCC 55056)
MKARGPFCIRHAAADTFAMVVFCFVTGMIIEIFVSGMTFQQSLASRTLSIPVNIAIAWPY
GVFRDYVLRQGRKISPTGWMKNLSDLVAYVLFQSPVYAAILFTVGASTDQIITAVATNAL
VSCGMGVLYGYFLDMCRRWFKVPGYTVSEG