Protein Info for CSW01_08745 in Vibrio cholerae E7946 ATCC 55056

Annotation: TetR/AcrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00440: TetR_N" amino acids 27 to 73 (47 residues), 45.9 bits, see alignment 4e-16 PF17939: TetR_C_30" amino acids 105 to 220 (116 residues), 107.3 bits, see alignment E=5.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1680)

Predicted SEED Role

"Predicted transcriptional regulator for fatty acid degradation FadQ, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>CSW01_08745 TetR/AcrR family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MWREYISNSCLIRVIEMALRSSTKEKILDVAEGLFAEYGFNDTSLRTITSKAGVNLASVN
YHFGDKKTLVRAVLNRYLEAFMPEMKQSLERLNERDDYDMAEVFEALRAPLRSLSELRPN
GTSRFMLLIGRGYTDVQGHLRWFITNRYNDVLTLFTDSVLKANPNLTRETLFWRLHFTLG
TCVFTMASSQALAEIAENDFGSKVDPKSVVDQLIPYLAAGVAAK