Protein Info for CSW01_08690 in Vibrio cholerae E7946 ATCC 55056

Annotation: glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 4 to 377 (374 residues), 502 bits, see alignment E=5e-155 PF00483: NTP_transferase" amino acids 6 to 273 (268 residues), 209.1 bits, see alignment E=1.2e-65 PF24894: Hexapep_GlmU" amino acids 295 to 397 (103 residues), 113.3 bits, see alignment E=8.8e-37 PF25247: LbH_GLGC" amino acids 304 to 349 (46 residues), 31.8 bits, see alignment 1.9e-11

Best Hits

Swiss-Prot: 100% identical to GLGC1_VIBCH: Glucose-1-phosphate adenylyltransferase 1 (glgC1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 100% identity to vch:VC1727)

MetaCyc: 44% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.27

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>CSW01_08690 glucose-1-phosphate adenylyltransferase (Vibrio cholerae E7946 ATCC 55056)
MAGVLGMILAGGEGSRLKPLTETRTKPAVPFGGSYRLIDFALNNFVNADLMRIYVLTQFK
SQSLYIHMKKGWNLSGITDRFIDIIPAQMRDGKRWYEGTADAIYQNLRFVEIVAPDQVCI
FGSDHIYKMDIRQMLDFHRRMEAELTVSALRMPISQASQFGVIEVDENGKMVGFEEKPSN
PKSIPGEPEWALVSMGNYIFEAETLSKELREDAENNQSSHDFGKDIIPKMFPRGKVYVYD
FTTNKIKGEKESTYWRDVGTIESYWSAHMDLLDKDPEFSLYNRSWPLHTYYPPLPPATFV
DVKDKKVKITDSLISGGSYIQGSTIYKSVLGFRSNIAAGSFISESVILGDVKIGAGCTIK
RAIIDKDVEIAAGTIIGEDLEMDRKRFHVSDEGIVVIAKGSKVGF