Protein Info for CSW01_08630 in Vibrio cholerae E7946 ATCC 55056

Annotation: condensin subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF03882: WHD_KicB" amino acids 10 to 122 (113 residues), 185.9 bits, see alignment E=3.4e-59 PF17192: MukF_M" amino acids 126 to 286 (161 residues), 271.6 bits, see alignment E=3.3e-85 PF17193: MukF_C" amino acids 288 to 445 (158 residues), 270.3 bits, see alignment E=1e-84

Best Hits

Swiss-Prot: 100% identical to MUKF_VIBCH: Chromosome partition protein MukF (mukF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03633, chromosome partition protein MukF (inferred from 100% identity to vco:VC0395_A1319)

Predicted SEED Role

"Chromosome partition protein MukF" in subsystem DNA structural proteins, bacterial or MukBEF Chromosome Condensation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>CSW01_08630 condensin subunit F (Vibrio cholerae E7946 ATCC 55056)
MSEFTQDTVQKPIDELVTWVKQYDFSLNLPTERLAFLLAIAVLSNERFDEELGEGELHDA
FAIVTRLFAESGEASAFRANNAINDLVKQRLLSRFTSEMTEGASIYRLTPLAIGITDYYV
RHREFSKLKLSIQLSMVADEMAKAVESAQQGGSVAHWRKNVFGVLKYSVSEIFDRIDLNQ
RVMDEQQQSVKEQIADLLNKDWRDAINNCEALLSETSATLRELQDTLQAAGDELQTQILD
IQECVYGDLELDFIEETLSALQMKLDRITSWGQQSIDLWIGYDRHVHKFIRTAIDMDQNR
AFSQRLRQSMNDYFEQPWYLTYADAERLSDLRDETLTLRDEEVTGHVPTEVEYEELQQVN
DELAQRIGDMLKVHKEQGAAIDLALVLRDYLASHPRTHHFDLARMVVDQAVRLGYSESDY
RAIQPDWTAINDFGAKVQANVIDRY