Protein Info for CSW01_08610 in Vibrio cholerae E7946 ATCC 55056

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF01810: LysE" amino acids 27 to 197 (171 residues), 54.7 bits, see alignment E=5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC1712)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>CSW01_08610 LysE family translocator (Vibrio cholerae E7946 ATCC 55056)
MHLTLIENIVMDYTLFGPLLAFAFVSTFSPGPNNIMLMTSGANVGFLRTIPHMLGITFGF
SIMVLLVGVGLTELFQRYPILQQGLQILCTLYLVYLAVKIALSRPSKEGQEYQPMSFVAA
ALFQWVNPKGWSMALTAVSVFNPNASWLQLGLIALVFALVNLPSVSAWTAAGKQLSYWMN
HPNYVRWFNGAMGGLLLLSVVPML