Protein Info for CSW01_08490 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 57 (57 residues), see Phobius details transmembrane" amino acids 66 to 83 (18 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 333 to 359 (27 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF11449: ArsP_2" amino acids 53 to 413 (361 residues), 528.4 bits, see alignment E=5.3e-163

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1628)

Predicted SEED Role

"Predicted manganese transporter, 11 TMS" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>CSW01_08490 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MSIIILIHCARYSMNSLKWPNMANHRVLVSLFNLRYKRLLLPIALFALLVSENTRAVTVE
TLADSFWAVSTYVAFTLAIYHWVSRWLDGAHALVSAYHRSRNLQVVIAALLGALPGCGGA
IVVTTQFVSGKVGFGALVAVLTATMGDAAFLLLASQPVTGLYVIGIGVVTGCITGLVINA
LHRDDFMRPALTELSNKLRTSCCSATSTVSFKAINLQGLFWKYLLLPASLVAFASSFQID
INQVLSLPEMSIEWIGALLAVSSMLLWALTQEIEDYQSTVSEDDKIRTSHPMQKAAQDTN
FVSAWVIIAFLAFELTLHFTGFEIGANWGNWGVWMPALGIMIGLLPGCGPQILVTSLYLS
GALPFSAQLSNAISNDGDALFPAIALAPKAALMATLYSSIPAAIVGYGYFWLFEM