Protein Info for CSW01_08445 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00496: SBP_bac_5" amino acids 78 to 455 (378 residues), 292 bits, see alignment E=3.7e-91

Best Hits

Swiss-Prot: 38% identical to HBPA_HAEIN: Heme-binding protein A (hbpA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 100% identity to vcm:VCM66_1620)

Predicted SEED Role

"Peptide transport periplasmic protein SapA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>CSW01_08445 ABC transporter substrate-binding protein (Vibrio cholerae E7946 ATCC 55056)
MNALLRFTLGLCSMTLLAGCGENIDHSKIRSSGFVYCGESAPTTFNPQLADNDITSDALG
PQIYNTLLTIDPETHLPVASLASSWTVNSTGLEYVFKLRPDVAFQTTPWFSPTRPLNADD
VVFSFRRIIDPTNPYHKVGQTQYPWFKGIDFQNLLVDVSALDDLTVKFVLSRPDNSFLSN
IATSHAVILSLEYANQLIIDDEKEKLDNLPLGTGPFYLAEYHPRDLIRLKRHPQYWEGAA
KVEQVVFDISQRGTGMLAKLLRNECDVLNAPISSQLPAIEKNPDIVLQTTPAMNVAFIAV
NTQHPALNDNRVRKALNFAINRQNILDSVYYGTGSIAFTILPPTSWAYQQDTAQIRYDRN
YAQALLREAGFATGLELTMSVPVEPKAYNPSPRKTAELIQANLADIGVTLRLISEDRSER
QELSIRNNIDLYLSGWTGDTGDPDNFLRPLLSCDSNRAGLNVSMWCDSDFDFLLDLALEA
NKPRYRLNLYHQAQNILNQEFPVIPLAHGIQFTAYSKSLTGIRISPFNVQPFNTVERVAE