Protein Info for CSW01_08420 in Vibrio cholerae E7946 ATCC 55056

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 34 to 337 (304 residues), 312.9 bits, see alignment E=1.1e-97 PF25973: BSH_CzcB" amino acids 60 to 183 (124 residues), 32 bits, see alignment E=2.4e-11 PF25876: HH_MFP_RND" amino acids 99 to 153 (55 residues), 35.8 bits, see alignment 2e-12 PF25893: HH_CzcB" amino acids 100 to 151 (52 residues), 31 bits, see alignment 5e-11 PF25967: RND-MFP_C" amino acids 271 to 325 (55 residues), 33.8 bits, see alignment 6.6e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to vco:VC0395_A1280)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>CSW01_08420 efflux RND transporter periplasmic adaptor subunit (Vibrio cholerae E7946 ATCC 55056)
MNKTLLAFSICSTLLVGCGKELPPVPEPDSRPAKLTTVSVGNNTFSRQFPATTAAGDRAV
LAFRVPGQLQTIDVLAGQEVKKGEVLARLNPDEYALLEQQASANFQLADVQFQRAQRLRQ
DKVVSEQDFDQAQANHNSAKATWEQAKANLRYTQLIAPYDGTISLIPAEQYEYVAAKQGV
MNIQTNQLLKVQFLLPDHLLNRFSRDGVEAHMVFDSFPNRQYPLQFQEIDTEADSKTRSY
KVTMVMERPNDVGILPGMAGRVSLMAPSGSATVIPTSALFAEQGGKYVWRVDDAGLVSKA
AVTLNEQRQVLTGLNDGDRIIISGVSGVTEGIKVREWVKERGL