Protein Info for CSW01_08355 in Vibrio cholerae E7946 ATCC 55056

Annotation: heat-shock protein HslJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03724: META" amino acids 33 to 140 (108 residues), 103.6 bits, see alignment E=3.1e-34

Best Hits

KEGG orthology group: K03668, heat shock protein HslJ (inferred from 100% identity to vch:VC1663)

Predicted SEED Role

"Heat shock protein HslJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>CSW01_08355 heat-shock protein HslJ (Vibrio cholerae E7946 ATCC 55056)
MKLSSKSLLAAITLPVLMTACASNGDAVQITAQDLQHHNWQLTQIDGKDVVKSEHEQAPR
LEIGEQMMASGNAGCNNFFGKAELKDNQFRIEKMGMTMKMCIGDAMDTEQAVSQTLTDWS
QITLTKETLTLKNDVHTLTFTLRDWVK