Protein Info for CSW01_08340 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 9 to 362 (354 residues), 63.3 bits, see alignment E=3.4e-21 PF12698: ABC2_membrane_3" amino acids 24 to 358 (335 residues), 171.9 bits, see alignment E=3.3e-54 PF01061: ABC2_membrane" amino acids 155 to 329 (175 residues), 107.7 bits, see alignment E=9.2e-35

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to vcm:VCM66_1600)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>CSW01_08340 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MNSLFRIKAVLVKEFRQLSRDRITFGMVVMIPLIQLLLFGFAINTDVRNIPIGVVDQSDS
SFSRLLVESVKVTQVIRVKQHYLTVNEAEKAIASGDIRAALILPSDLVARSQQQRELGQW
LIDGSDTMIAGALLGLKNMPLTDLPTLGIQPLTPTFEITLLYNPSRRSAVNIVPGLLGVI
LTMTMILFTSAAIVRERERGNLELLITTPVHSIELMIGKIVPYIFVGLIQVAIILGLGHF
IFAVPINGALSQILFGTLLFISASLTLGLVISTIANTQLQAMQMTVFILLPSILLSGFMF
PYEGMPTAAQWLSELLPATHFMRLIRGIVLRGADLADLWRDTLWLALFTLFGLMLAALRF
KKSLD