Protein Info for CSW01_08335 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF00005: ABC_tran" amino acids 22 to 164 (143 residues), 121.4 bits, see alignment E=6.8e-39 PF13304: AAA_21" amino acids 113 to 194 (82 residues), 27.6 bits, see alignment E=4.8e-10

Best Hits

Swiss-Prot: 40% identical to NODI_BRADU: Nod factor export ATP-binding protein I (nodI) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 100% identity to vcm:VCM66_1599)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>CSW01_08335 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MSDYAIHAENVVKQFGHFTAIENINLKVERGSIYGFLGPNGCGKSTTIRVLTGLLQPTAG
QIKVLGLSIPKQSELLRLKIGYMTQKFSLYDDLTVQENLQFIGQIFGMNRSTLQQRTQAQ
LKTYGLDERRKQRVSGMSGGQKQRLALAAATMHNPELLFLDEHTSAVDPENRREFWEQLF
DLSAQGTTILVTTHYMDEAERCHRLAIMEAGEIRADDEPEKLMQQMGVNVVEIKAPALRS
LKEKLLNFSQVRSAAQLGIRLRVLVHRDVIDPILWLRHTFPQLAAAELTLARPSLEDVFV
TVTGKGRQ