Protein Info for CSW01_08105 in Vibrio cholerae E7946 ATCC 55056

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 8 to 235 (228 residues), 261.4 bits, see alignment E=7.2e-82 PF13432: TPR_16" amino acids 75 to 131 (57 residues), 24 bits, see alignment E=2.4e-08 amino acids 115 to 171 (57 residues), 28.9 bits, see alignment E=6.9e-10 PF13431: TPR_17" amino acids 92 to 124 (33 residues), 26.5 bits, see alignment 2.7e-09 PF13424: TPR_12" amino acids 104 to 168 (65 residues), 35.3 bits, see alignment E=5.8e-12 PF13374: TPR_10" amino acids 106 to 131 (26 residues), 20.1 bits, see alignment (E = 3e-07) PF13181: TPR_8" amino acids 141 to 171 (31 residues), 19.3 bits, see alignment 5.3e-07 PF07719: TPR_2" amino acids 141 to 171 (31 residues), 25 bits, see alignment 7.7e-09 PF13174: TPR_6" amino acids 144 to 171 (28 residues), 18.5 bits, see alignment (E = 1.4e-06)

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 100% identity to vco:VC0395_A1217)

Predicted SEED Role

"Type IV pilus (Tfp) assembly protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>CSW01_08105 type IV pilus biogenesis/stability protein PilW (Vibrio cholerae E7946 ATCC 55056)
MKNVFGLGLIIALAGCVTVTETAGNATQSDPTEMAEARIALGLGYLENGSMIKARENLEK
ALQHAPDYYRSQLSMAHYYEAVGENDSARKMYRTALSEHPKNGNVLNNFGTFLCKQGEYD
TADQYFRRAVEQPYYYLISASYENAGLCALKAGKTDNAREYFKRAIDHDPNRLLSILQLT
KMEIEAGDYTPARLRLMDLNQRYGYQKASLKLLIELEKRAGNSALEQKYQTLLNSLS