Protein Info for CSW01_08090 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 122 to 132 (11 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 21 to 368 (348 residues), 174.1 bits, see alignment E=4.5e-55 PF01061: ABC2_membrane" amino acids 227 to 337 (111 residues), 37.6 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to vch:VC1609)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>CSW01_08090 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MTLFELFKAELKALFTNPVVVLTVFGGVVFYSFLYPLPYAKQIPREQTVSVVNLDQSQAS
FQLERMVDATPQVKIVQRDHTIADAKQAFLDKKVAGILVIPEHFYKDLLLGKSPTLAYAG
DASYFLVYGTIVEGLAQAGGTLAAQTKVSRLVIEGEPMAFAAQHFSPTSANLKPTFNPRM
GYVDYVVPAVFVLILQQTLIMAAGLMVGTQKQGHGYWSRVAPAKLLLVRSFVLVAVYYLL
SLYYFGASFDLHGVNTLAKPNDLISLLLPFLLACNFVGIALGAVTPRRELVTLVVLISSM
PLIFTAGFIWPLEMIPAPLVWLAQCFPSTPAIQGFLGLNQMAASWSTIAPKWTLLWAQAL
VWGGLAFYLLRRVRQRTAKPPQ