Protein Info for CSW01_07910 in Vibrio cholerae E7946 ATCC 55056

Annotation: ASCH domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF04266: ASCH" amino acids 7 to 103 (97 residues), 73.4 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 100% identical to Y1516_VIBCM: UPF0267 protein VCM66_1516 (VCM66_1516) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K09900, hypothetical protein (inferred from 98% identity to vco:VC0395_A1180)

MetaCyc: 41% identical to N4-acetylcytidine amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-21270 [EC: 3.5.1.135]

Predicted SEED Role

"RNA-binding domain protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.135

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>CSW01_07910 ASCH domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MSISTQITFFEFLTPLVASGQKTITIRDKSESHYVPGTRVEVFTLETQRKVCEIDILAVE
PLKFDEINEFHAEQEAIELPKLKALIQEIYPNIDELYVITYQLAK