Protein Info for CSW01_07895 in Vibrio cholerae E7946 ATCC 55056

Annotation: class II fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00206: Lyase_1
  • amino acids 13 to 337 (325 residues), 311.4 bits, E=8.2e-97
• PF10415: FumaraseC_C
  • amino acids 403 to 456 (54 residues), 69 bits, 3.7e-23

Best Hits

Swiss-Prot: 65% identical to FUMC2_PSEAE: Fumarate hydratase class II 2 (fumC2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 100% identity to vcj:VCD_002804)

MetaCyc: 48% identical to fumarase C (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• mixed acid fermentation (15/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• reductive TCA cycle II (8/12 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• methylaspartate cycle (9/19 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Protein Sequence (461 amino acids)

>CSW01_07895 class II fumarate hydratase (Vibrio cholerae E7946 ATCC 55056)
MTREYRIEKDSMGEVKVPADALYQAQTQRAVDNFTLSRYTMPSAFIAALAYIKQAAAMTN
AQLGHLEGDIAQAIANASQAVIDGQYAKQFPIDVFQTGSGTSSNMNANEVIATLASRELG
YAVSPNDHVNMGQSSNDVIPTAIQVSAAINIEQQLLPALAHLSQTLADKQSELADVVKTG
RTHLMDAMPVTFAQELGGWKSQIDHAAQGISHALSPIKALAQGGTAVGTGINADPRFARI
FADNLSQLSHVAFQPSDNFFYNLSSQDCVVGLSGQLKTAAVALMKIANDLRWMNSGPLAG
LGEIELQGLQPGSSIMPGKVNPVIPEAVTMVAAQVIGNDTTITVAGQSGNFQLNVMLPVI
AHNLLESIELLTNACHALADKAIATFKVRHDNLEKALAKNPILVTALNPVIGYLKAADIA
KKAYQQGRAILDVAAEETDLDRATLEALLDPKKLTQGGIAH