Protein Info for CSW01_07665 in Vibrio cholerae E7946 ATCC 55056

Annotation: bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/molybdopterin molybdotransferase MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B" amino acids 17 to 172 (156 residues), 142.4 bits, see alignment E=1.2e-45 PF03205: MobB" amino acids 17 to 149 (133 residues), 156.6 bits, see alignment E=6.8e-50 PF03453: MoeA_N" amino acids 207 to 367 (161 residues), 149.9 bits, see alignment E=1e-47 TIGR00177: molybdenum cofactor synthesis domain" amino acids 377 to 513 (137 residues), 113.4 bits, see alignment E=9.2e-37 PF00994: MoCF_biosynth" amino acids 380 to 517 (138 residues), 111 bits, see alignment E=8.1e-36 PF03454: MoeA_C" amino acids 531 to 602 (72 residues), 71.6 bits, see alignment E=1e-23

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to vcj:VCD_002848)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB / Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>CSW01_07665 bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/molybdopterin molybdotransferase MoeA (Vibrio cholerae E7946 ATCC 55056)
MIASAHQNPQRPNLPLLGFAAYSGTGKTTLLEALLPKLTATGLRIGLLKHAHHDFDVDKP
GKDSYRLRKAGASQMLIASRNRHALMTETPDAEAEFDYLLTRFDAEKLDVILVEGCKNIA
FPKIELHRAEVGKPWLYPHDKNIIAIAADETVATDLPQMHINDLDAIADFVLDYVNKWRA
QQIQPHTVSDSKNNAAACCDTLSPAFLSVEQGREKILSLISPLAETESVAIQECYQRVLA
REVFSPNNVPAYRNSAMDGYALRSDDLERDSYRVVAEVLAGSHYPKTVERGEAVKIMTGA
PMPLGADTVVMREQATQNGELVSFAGAKIKAGQNVRQAGEDLAQGQAVFSIGQRVLSPEM
GMLASLGFAHADAFRSLKVAIFSTGDEVQAPGGDIEPNSIFDSNRFTLTGLLKQLGCQVI
DLGIIEDDEAKMMQVLEQAAKQADVVITSGGVSVGDADFIKSALEKLGQIDFWRINMRPG
RPLAFGQIAGKPFFGLPGNPVAVMVSFINFVEPALRKMQGEQGWQPLKVNAIALEDLRSR
QGRTEFSRGVYAFNTQGQLTVRTTGKQGSGILRSMSEANCLIEIAPAIDTVKVGESVTII
PLQGRI