Protein Info for CSW01_07640 in Vibrio cholerae E7946 ATCC 55056

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF00072: Response_reg" amino acids 18 to 128 (111 residues), 82.4 bits, see alignment E=1.1e-26 PF00158: Sigma54_activat" amino acids 155 to 321 (167 residues), 232.2 bits, see alignment E=1.1e-72 PF14532: Sigma54_activ_2" amino acids 156 to 325 (170 residues), 56 bits, see alignment E=2.2e-18 PF00004: AAA" amino acids 179 to 301 (123 residues), 23.9 bits, see alignment E=2e-08 PF07728: AAA_5" amino acids 179 to 298 (120 residues), 34.7 bits, see alignment E=6.8e-12 PF25601: AAA_lid_14" amino acids 326 to 385 (60 residues), 53 bits, see alignment E=1e-17 PF02954: HTH_8" amino acids 435 to 475 (41 residues), 33.2 bits, see alignment 1.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A1129)

Predicted SEED Role

"Sigma-54 dependent response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>CSW01_07640 sigma-54-dependent Fis family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MSPVLDLNQTHLYQAFSVLLVDDEVGMQLVLKKALSKWFSRVDLASSIEEAEVLRGEHHY
DLLILDINLPGRSGIEWEEAFTDPDHRADVIFMTGFADLETAISALKLGASDFILKPFNL
EQMLQAVQRCMNKRLNERLQYALQRDFQRHCTTQIIGSSVQTELLKQRIVQFAPSRASVL
IEGESGTGKELVARGIHEASGRQGPFVPINCGAIAPELLESELFGHTSGAFTGAKKSREG
LFRVANGGTLFLDEIGEMPLTMQASLLRVLEQRAVRPVGSEKEVNVDVRVVAATNRNLQQ
EVENGRFRGDLYYRLNVLKIEVSPLRERKQDLHELLPFFTKMLCAELGMPMPKWAYEDIS
SMQDYDWPGNIRELKNLIERCLLLGKPPAHYWRELNGLPIYAEPEVTMSQSNNSEISLGD
NVTQPSLGYPNDWPLSAVEKAHIQQIVALHEGNKSAAARDLGVARKTLERKYKEWESEDL
SHES